• CAS
  • |
  • C&EN
  • |
  • Journals
  • |
  • ACS

search site
Advanced Search »
  • Home
  • |
  • About CAS
    • CAS Media Library
    • CAS Quotes
    • Colors of Chemistry
    • 100th Anniversary Celebration
    • Careers at CAS
    • FAQs
    • Directions to CAS
    • Contact Us
  • |
  • Our Expertise
    • CAS Databases
    • Value Added Tools
    • Technical Service and Support
  • |
  • Solutions
    • Researchers
    • Professional Searchers
  • |
  • Products & Services
    • SciFinder
    • STN Family of Products
    • Science IP
    • CAS Client Services
    • CD Products
    • Print Products
  • |
  • Support & Training
    • CAS Learning Solutions
    • SciFinder
    • STN
    • STN Express
    • STN AnaVist
    • STN Viewer
    • STN on the Web
    • STN Easy
    • Academic Community
    • CAS Customer Center
  • |
  • News & Events
    • Press Room
    • News Releases
    • Product Updates
    • Mentions
    • Insights
    • Trade Shows
    • ACS on Campus
  • Database News
  • STNews Home
  • Articles
  • Take Note
Home   •   Support and Training  •  STN  •  STNews  •  Database News  •  Jan/Feb 2010
Database News for January and February 2010

Index

  • CA/CAplus Adds 60th Patent Authority
  • CA/CAplus Has New Indicator for Additional Basic Patents
  • Derwent World Patents Index (DWPI)
  • INPADOCDB and INPAFAMDB
  • INSPEC
  • MEDLINE
  • USGENE and PCTGEN

CAS Adds Intellectual Property Office of the Philippines as 60th Patent Authority in Its Patent Coverage

CAS has enhanced its extensive patent coverage by adding patent and patent family information from the Intellectual Property Office of the Philippines (IP Philippines), increasing the number of patent authorities covered to 60.

The CA/CAplus databases are a rich source of unique, difficult-to-locate Asian patent content provided by patent authorities in Hong Kong, Japan, the People's Republic of China, the Republic of Korea, Singapore, and Taiwan.  The addition of information from the IP Philippines further enriches CAS' Asian patent coverage.

Patents emerging from smaller patent authorities are often the source of unique inventions.  This information is also largely inaccessible to many patent searchers because few information providers cover smaller patent authorities.  With CAS' broad coverage of 60 worldwide patent authorities--many of them smaller patent offices--you can be sure you will not miss this important, one-of-a-kind information.


New CA/CAplus Indicator Identifies Additional Basic Patent Records Containing Equivalent Chemical Indexing 

Now you can identify the multiple basic records in the CA/CAplus databases that have equivalent chemical indexing.

These duplicate records occur as a result of CAS' efforts to provide maximum coverage of substance information disclosed in patents. On July 1, 2008, CAS began adding as basic patents both Patent Cooperation Treaty (PCT) applications and their original national equivalents (those with the oldest priority from the U.S., Germany, United Kingdom, France, Canada, and/or the EPO).  This policy was further expanded to include applications from Japan and Russia on January 1, 2009.

An estimated 13,000 patent records added to the CA/CAplus family of databases since 2008 have equivalent chemical indexing because there is no difference between CAS Registry Numbers indexed in the PCT application(s) and in their original national application(s).

To enable you to identify records that contain equivalent chemical indexing, an indicator has been added to the Source (SO) field.  The indicator consists of:

  • a phrase of searchable text containing the words: Chemical Indexing Equivalent to
  • up to two related document number(s)
  • the patent country code for the patent with the equivalent chemical indexing

Note the additional information in the SO field in the following sample record:

L1   ANSWER 1 OF 1  CAPLUS  COPYRIGHT 2009 ACS on STN
AN   2009:1252786  CAPLUS
DN   151:451634
TI   Process for cleaning articles
PA   Dow Global Technologies Inc., USA
SO   Eur. Pat. Appl.,10pp.; Chemical Indexing Equivalent to
     151:451638 (WO)  CODEN: EPXXDW
DT   Patent
LA   English
FAN.CNT 2
        PATENT NO.     KIND  DATE      APPLICATION NO.  DATE
PI      EP 2108464     A1    20091014  EP 2008-103465   20080409
        WO 2009126369  A1    20091015  WO 2009-US34346  20090218
PRAI EP 2008-103465    A     20080409    
RE.CNT  3  THERE ARE 3 CITED REFERENCES AVAILABLE FOR THIS RECORD
ALL CITATIONS AVAILABLE IN THE RE FORMAT

CAS is working to develop more robust solutions for identifying records that contain equivalent chemical indexing.  Until these solutions are available, use the following interim strategies:

  • To retain PCT applications (and remove national basics) in an L-number answer set, use

        S L# not (chemical indexing equivalent/so not wo/pc.b)

  • To remove PCT applications (and retain national basics) in an L-number answer set, use

        S L# not (chemical indexing equivalent/so and wo/pc.b)

You can also use the FSORT command to reduce each patent family in your answer set to a single representative; however, keep in mind that FSORT may also remove Continuations-In-Part (CIPs) and Divisionals.


Derwent World Patents Index (DWPI) Revises Indexing of Author Abstracts

Following customer requests, the indexing of author abstracts in the DWPI databases (WPINDEX/WPIDS/WPIX) has been revised.

In a first step, additional language-specific search fields /ABEN, /ABDE, /ABES,
/ABFR, and /ABOL (Abstracts Other Languages) are being provided and the indexing of the author abstracts in the /AB index field discontinued.  Simultaneous Left and Right Truncation is available for the new index fields.  This measure serves to resolve ambiguities across languages.

In a second step, the author abstracts will be purged from the /AB index Field in February.  This addresses customer requirements for a more clear-cut distinction between first level and value-added data.

In order to take advantage of the improvements and recognize the changes, adjustments to existing routines may be required. In particular, SOI strategies should be reviewed.

For additional information about this database, refer to the STN Database Summary Sheets page.

For pricing information, see HELP COST in the database. 


INPADOCDB and INPAFAMDB Enriched with New Content and Features

The INPADOC files have been enhanced with the following new content and new SELECT fields: 

  • About 8.6 million English abstracts for Japanese unexamined patent applications (JPA/PK) since 1976 have been added.
  • The cited patent information in the INPADOC files has been enhanced with patent assignee names of the cited patent numbers.  These new cited patent assignee names (/PAS.D) are available for search, display, and analysis.
     
  • Two new SELECT fields for enhanced analysis of priority countries are available.  The field PRCF identifies the country of the first priority, and the field PRCF.WO can be used to identify the country where a first PCT priority was filed.

For more information, see

       http://www.stn-international.de/INPADOC_NEWS_201001.pdf

      http://www.stn-international.de/INPADOC_NEWS_201002.pdf

For additional information about these databases, refer to the STN Database Summary Sheets page.


INSPEC Adds Its Own IPC Scheme and Author E-mail Addresses

INSPEC (Information Service for Physics, Electronics and Computing), produced by The Institution of Engineering and Technology (IET), is mapping its own indexing schemes to the WIPO IPC system for assigning IPC codes to relevant records.

Initial trials indicate that about 75% of INSPEC records will contain IPC codes, and that the average record containing these codes will have two INSPEC-mapped IPC codes assigned to it.  The IPC scheme and that of INSPEC do not cover exactly the same conceptual territory or approach.  Consequently the level of precision of the IPC codes applied varies depending on the relationships between the schemes and specific subjects themselves.

The IPC codes are indexed and displayed in the new search field /IPC. An online thesaurus has also been installed.

Additionally, the combined code and text is indexed and displayed as a bound phrase in the classification code (/CC) field.  Single terms from the IPC text are also searchable.  The backfile to 1969 (but not the archive) will be loaded later this year.

For more information about IPC codes that occur in INSPEC records, see:

http://www.stn-international.de/inspec_ipc.html.

A further enhancement of INSPEC: Author E-mail addresses are now searchable in /EML and /CS and displayed in field AU.  EML is a custom display only.

For additional information about this database, refer to the STN Database Summary Sheets page.


More Than 400 New MeSH Headings Included in 2010 Reload of MEDLINE

 

The annual reload of the MEDLINE database on STN includes the addition of more than 400 new MeSH headings.  You can find the linking ISSN data in the ISN and SO fields.  For full details of the 2010 MeSH vocabulary, visit

http://www.nlm.nih.gov/pubs/techbull/nd09/nd09_medline_data_changes_2010.html.

For additional information about this database, refer to the STN Database Summary Sheets page.


New FASTA Display Formats Added to USGENE and PCTGEN

 

The new sequence display formats FASTA and FASTA2 have been added to the sequence databases USGENE and PCTGEN.  These FASTA display formats are widely accepted by third party sequence analysis tools, so that sequence search results from USGENE and PCTGEN can directly be used for further analysis.

The new FASTA format comprises a header line providing a unique description of the sequence (accession number, sequence identity number, and patent publication number) and the actual sequence in lines of 70 characters.  FASTA2 is a lower-priced alternative format that provides the same sequence information with a truncated header line.

FASTA and FASTA2 can be used in combination with the standard display formats ALL and BRIEF without generating additional costs.

Examples of the new FASTA and FASTA2 formats:

=> D FASTA



FASTA: >USGENE|20100017904.32958|Protein|sequence 32958 from US20100017904 mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp

=> D FASTA2
FASTA2:
>USGENE|Protein mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp

For additional information about these databases, refer to the STN Database Summary Sheets page.

Updated 3/1/2010 9:34:45 AM
Share/Bookmark
Home  |  About CAS  |  Our Expertise  |  Solutions  |  Products & Services  |  Support & Training  |  News & Events
Copyright © 2012 American Chemical Society